PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Eucgr.E01031.1.p
Common NameEUGRSUZ_E01031, LOC104444093
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Myrtales; Myrtaceae; Myrtoideae; Eucalypteae; Eucalyptus
Family MYB
Protein Properties Length: 318aa    MW: 36404 Da    PI: 7.7765
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Eucgr.E01031.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding49.51e-151461148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
   Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                      rg+WT  Ed  lv++++ +G g+W++ +++ g+ R++k+c++rw +yl
  Eucgr.E01031.1.p 14 RGPWTNKEDTVLVKYIQTHGEGHWRSLPKKAGLLRCGKSCRLRWMNYL 61
                      89******************************99************97 PP

2Myb_DNA-binding513.3e-1667112148
                       TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
   Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                       rg+ T++E++l+ +++++lG++ W++Ia +++ gRt++++k++w+++l
  Eucgr.E01031.1.p  67 RGNITPDEEDLIMRLHALLGNR-WSLIAGRLP-GRTDNEIKNYWNSHL 112
                       7999******************.*********.************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129415.8961IPR017930Myb domain
SuperFamilySSF466892.51E-2911108IPR009057Homeodomain-like
SMARTSM007179.2E-121363IPR001005SANT/Myb domain
PfamPF002491.0E-131461IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.606.1E-231568IPR009057Homeodomain-like
CDDcd001675.71E-81661No hitNo description
PROSITE profilePS5129425.91562116IPR017930Myb domain
SMARTSM007177.1E-1566114IPR001005SANT/Myb domain
PfamPF002497.8E-1567112IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.3E-2569116IPR009057Homeodomain-like
CDDcd001672.17E-971112No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 318 aa     Download sequence    Send to blast
MGRAPCCSKV GLRRGPWTNK EDTVLVKYIQ THGEGHWRSL PKKAGLLRCG KSCRLRWMNY  60
LRPDIKRGNI TPDEEDLIMR LHALLGNRWS LIAGRLPGRT DNEIKNYWNS HLSKRVATDS  120
NENHSKGLRG PKKRSNNNLI TANKKKRRSE KSPQEDREEE EEEVATTKKI KVHQPKAIRV  180
SHIFSIARNN SFETVEVADK EVMAHDKRES NDVIINSNND LSWMMSEAKE HNWFCDDEDY  240
NDMVDVEGCG GGGGGCGDEM ICSNDDKNTS SSSPCHRIWL PNNNNKKMLE KIFEEYHELL  300
KSEDHLQMES FVDSLLI*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A2e-25121185110B-MYB
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1131147KKRSNNNLITANKKKRR
2143147KKKRR
Cis-element ? help Back to Top
SourceLink
PlantRegMapEucgr.E01031.1.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010055996.10.0PREDICTED: myb-related protein 308-like
TrEMBLA0A059C2780.0A0A059C278_EUCGR; Uncharacterized protein
STRINGPOPTR_0003s14420.19e-95(Populus trichocarpa)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G49330.12e-66myb domain protein 111